SFRS8 (SFSWAP) Rabbit Polyclonal Antibody

CAT#: TA345880

Rabbit Polyclonal Anti-SFRS8 Antibody

Product Images

WB Suggested Anti-SFRS8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate; SFSWAP is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8. Synthetic peptide located within the following region: LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 105 kDa
• Gene Name: splicing factor SWAP homolog
• Database Link:
  NP_004583
  Entrez Gene 6433 Human
  UniProt ID Q12872
• Background: SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified although their full-length natures have not been characterized to date.
• Synonyms: SFRS8; SWAP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors