Antibodies

Jump to Filters
View as table Download
SHISA7 Rabbit Polyclonal Antibody
TA330840

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHISA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHISA7 antibody is: synthetic peptide directed towards the middle region of Human SHISA7. Synthetic peptide located within the following region: INVPRALVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNT