SHISA7 Rabbit Polyclonal Antibody

CAT#: TA330840

Rabbit Polyclonal Anti-SHISA7 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SHISA7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SHISA7 antibody is: synthetic peptide directed towards the middle region of Human SHISA7. Synthetic peptide located within the following region: INVPRALVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 59 kDa
Gene Name shisa family member 7
Background The function of this protein remains unknown.
Synonyms DKFZp547H0214; FLJ34341; FLJ37640; FLJ45290; MGC120935; MGC138402
Note Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.