Antibodies

View as table Download

Rabbit Polyclonal SHISA9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SHISA9 antibody was raised against a 22 amino acid synthetic peptide near the center of human SHISA9.

Rabbit Polyclonal Anti-SHISA9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHISA9 antibody is: synthetic peptide directed towards the middle region of Human SHISA9. Synthetic peptide located within the following region: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT