SHISA9 Rabbit Polyclonal Antibody

CAT#: TA330841

Rabbit Polyclonal Anti-SHISA9 Antibody

Product Images

Host: Rabbit; Target Name: SHISA9; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SHISA9 antibody is: synthetic peptide directed towards the middle region of Human SHISA9. Synthetic peptide located within the following region: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: shisa family member 9
• Database Link:
  NP_001138676
  Entrez Gene 729993 Human
  UniProt ID B4DS77
• Background: The function of this protein remains unknown.
• Synonyms: CKAMP44
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%