Antibodies

View as table Download

SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit polyclonal Anti-SHMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG

SHMT1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence LVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALT

SHMT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SHMT1

SHMT1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SHMT1

SHMT1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 285-444 of human SHMT1 (NP_683718.1).
Modifications Unmodified

SHMT1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 285-444 of human SHMT1 (NP_683718.1).

SHMT1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 285-444 of human SHMT1 (NP_683718.1).
Modifications Unmodified