Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLAIN2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLAIN2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLAIN2. Synthetic peptide located within the following region: VPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGP |
Rabbit Polyclonal Anti-SLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLA antibody: synthetic peptide directed towards the middle region of human SLA. Synthetic peptide located within the following region: PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG |
Slap (SLA) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from the human SLAP1 protein. |
SLA Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLA |
SLA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLA |
Active filters
Target Symbol
- SLA