Slap (SLA) Rabbit Polyclonal Antibody

CAT#: TA346438

Rabbit Polyclonal Anti-SLA Antibody

Product Images

WB Suggested Anti-SLA Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLA antibody: synthetic peptide directed towards the middle region of human SLA. Synthetic peptide located within the following region: PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: Src-like-adaptor
• Database Link:
  NP_006739
  Entrez Gene 6503 Human
  UniProt ID Q13239
• Background: SLA is an adapter protein, which negatively regulates T-cell receptor (TCR) signaling. SLA inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. SLA is involved in the negative regulation of positive selection and mit
• Synonyms: SLA1; SLAP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome