Antibodies

Jump to Filters
View as table Download
SLC15A4 Rabbit Polyclonal Antibody
TA333497

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SLC15A4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC15A4 Antibody: synthetic peptide directed towards the N terminal of human SLC15A4. Synthetic peptide located within the following region: MEGSGGGAGERAPLLGARRAAAAAAAAGAFAGRRAACGAVLLTELLERAA
SLC15A4 Rabbit Polyclonal Antibody
TA334601

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SLC15A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC15A4 antibody: synthetic peptide directed towards the middle region of human SLC15A4. Synthetic peptide located within the following region: GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH