SLC15A4 Rabbit Polyclonal Antibody

CAT#: TA334601

Rabbit Polyclonal Anti-SLC15A4 Antibody

Product Images

WB Suggested Anti-SLC15A4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

• 

  Host: Rabbit; Target Name: SLC15A4; Sample Tissue: 293T; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 0

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC15A4 antibody: synthetic peptide directed towards the middle region of human SLC15A4. Synthetic peptide located within the following region: GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: solute carrier family 15 member 4
• Database Link:
  NP_663623
  Entrez Gene 121260 Human
  UniProt ID Q8N697
• Background: SLC15A4 is the proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
• Synonyms: FP12591; PHT1; PTR4
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%