Germany
Japan
United Kingdom
China
SLC17A1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC17A1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC17A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC17A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC17A1. Synthetic peptide located within the following region: VHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNW |
Rabbit Polyclonal Anti-SLC17A1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC17A1 |
SLC17A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A1 (NP_005065.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC17A1