Rabbit Polyclonal Anti-SLC19A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC19A1 antibody: synthetic peptide directed towards the N terminal of human SLC19A1. Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP |
SLC19A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC19A1 |
SLC19A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 452-591 of human SLC19A1 (NP_919231.1). |
| Modifications | Unmodified |
SLC19A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 452-591 of human SLC19A1 (NP_919231.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
