SLC19A1 Rabbit Polyclonal Antibody

CAT#: TA334631

Rabbit Polyclonal Anti-SLC19A1 Antibody

Product Images

WB Suggested Anti-SLC19A1 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate;SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC19A1 antibody: synthetic peptide directed towards the N terminal of human SLC19A1. Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: solute carrier family 19 member 1
• Database Link:
  NP_919231
  Entrez Gene 6573 Human
  UniProt ID P41440
• Background: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate. [supplied by OMIM]
• Synonyms: CHMD; FOLT; IFC1; REFC; RFC1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transmembrane