USD 375.00
5 Days
Rabbit Polyclonal Anti-SLC25A10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A10 antibody is: synthetic peptide directed towards the middle region of Human SLC25A10. Synthetic peptide located within the following region: PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG |
USD 360.00
5 Days
SLC25A10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC25A10 |
USD 360.00
5 Days
SLC25A10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC25A10 |
Germany
Japan
United Kingdom
China