Mitochondrial dicarboxylate carrier (SLC25A10) Rabbit Polyclonal Antibody

CAT#: TA331226

Rabbit Polyclonal Anti-SLC25A10 Antibody

Product Images

WB Suggested Anti-SLC25A10 Antibody; Titration: 1.0 ug/ml; Positive Control: THP-1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A10 antibody is: synthetic peptide directed towards the middle region of Human SLC25A10. Synthetic peptide located within the following region: PFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: solute carrier family 25 member 10
• Database Link:
  NP_036272
  Entrez Gene 1468 Human
  UniProt ID Q9UBX3
• Background: The dicarboxylate carrier catalyzes the transport of dicarboxylates such as malate and succinate across the mitochondrial membrane in exchange for phosphate, sulfate, and thiosulfate, thus supplying substrates for the Krebs cycle, gluconeogenesis, urea synthesis, and sulfur metabolism.
• Synonyms: DIC
• Note: Human: 100%; Sheep: 86%; Bovine: 86%; Zebrafish: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%