Germany
Japan
United Kingdom
China
SLC25A20 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC25A20 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC25A20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A20 Antibody: synthetic peptide directed towards the middle region of human SLC25A20. Synthetic peptide located within the following region: SSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEW |
Rabbit Polyclonal Anti-SLC25A20 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A20 Antibody: synthetic peptide directed towards the C terminal of human SLC25A20. Synthetic peptide located within the following region: GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL |
Rabbit Polyclonal Anti-SLC25A20 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC25A20 |
SLC25A20 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-301 of human SLC25A20 (NP_000378.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC25A20