SLC25A20 Rabbit Polyclonal Antibody

CAT#: TA334168

Rabbit Polyclonal Anti-SLC25A20 Antibody

Product Images

WB Suggested Anti-SLC25A20 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HT1080 cell lysate;SLC25A20 is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A20 Antibody: synthetic peptide directed towards the middle region of human SLC25A20. Synthetic peptide located within the following region: SSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: solute carrier family 25 member 20
• Database Link:
  NP_000378
  Entrez Gene 788 Human
  UniProt ID O43772
• Background: This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants. [provided by RefSeq, Jul 2008]
• Synonyms: CAC; CACT
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Sheep: 86%; Rabbit: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane