Rabbit Polyclonal Anti-Slc26a2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Slc26a2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA |
SLC26A2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse S26A2 |
SLC26A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human SLC26A2 (NP_000103.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China