SLC26A2 Rabbit Polyclonal Antibody

CAT#: TA334176

Rabbit Polyclonal Anti-Slc26a2 Antibody

Product Images

WB Suggested Anti-Slc26a2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Slc26a2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VSMQLSHDPLEVHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAVGIQVLLA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Database Link:
  NP_000103
  Entrez Gene 13521 Mouse
• Background: As a sulfate transporter, Slc26a2 may play a role in endochondral bone formation.
• Synonyms: D5S1708; DTD; DTDST; EDM4; MST153; MSTP157
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane