Rabbit Polyclonal Anti-SLC2A4RG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4RG antibody is: synthetic peptide directed towards the N-terminal region of Human SLC2A4RG. Synthetic peptide located within the following region: MERPPPRAAGRDPSALRAEAPWLRAEGPGPRAAPVTVPTPPQGSSVGGGF |
Rabbit Polyclonal Anti-SLC2A4RG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4RG antibody is: synthetic peptide directed towards the C-terminal region of Human SLC2A4RG. Synthetic peptide located within the following region: HSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKV |
Anti-SLC2A4RG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 351-368 amino acids of human SLC2A4 regulator |
Rabbit polyclonal HDBP1 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-242 amino acids from the Central region of human HDBP1. |
Rabbit Polyclonal Anti-SLC2A4RG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A4RG Antibody: synthetic peptide directed towards the middle region of human SLC2A4RG. Synthetic peptide located within the following region: MQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPT |
Carrier-free (BSA/glycerol-free) SLC2A4RG mouse monoclonal antibody,clone OTI1D9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLC2A4RG mouse monoclonal antibody,clone OTI4B3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLC2A4RG mouse monoclonal antibody,clone OTI4B6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLC2A4RG mouse monoclonal antibody,clone OTI2A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLC2A4RG mouse monoclonal antibody,clone OTI8A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SLC2A4RG Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SLC2A4RG. |
SLC2A4RG mouse monoclonal antibody,clone OTI1D9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI1D9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI1D9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLC2A4RG mouse monoclonal antibody,clone OTI1D9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SLC2A4RG mouse monoclonal antibody,clone OTI4B3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI4B3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI4B3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLC2A4RG mouse monoclonal antibody,clone OTI4B3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SLC2A4RG mouse monoclonal antibody,clone OTI4B6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI4B6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI4B6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLC2A4RG mouse monoclonal antibody,clone OTI4B6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SLC2A4RG mouse monoclonal antibody,clone OTI2A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI2A5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI2A5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLC2A4RG mouse monoclonal antibody,clone OTI2A5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SLC2A4RG mouse monoclonal antibody,clone OTI8A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI8A3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SLC2A4RG mouse monoclonal antibody,clone OTI8A3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLC2A4RG mouse monoclonal antibody,clone OTI8A3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
