Germany
Japan
United Kingdom
China
SLC2A8 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC2A8 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC2A8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC2A8 Antibody: synthetic peptide directed towards the middle region of human SLC2A8. Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW |
SLC2A8 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC2A8 |
SLC2A8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human SLC2A8 (NP_055395.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC2A8