GLUT8 (SLC2A8) Rabbit Polyclonal Antibody

CAT#: TA333867

Rabbit Polyclonal Anti-SLC2A8 Antibody

Product Images

WB Suggested Anti-SLC2A8 Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysate

• 

  Host: Rabbit; Target Name: SLC2A8; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SLC2A8; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC2A8 Antibody: synthetic peptide directed towards the middle region of human SLC2A8. Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: solute carrier family 2 member 8
• Database Link:
  NP_055395
  Entrez Gene 29988 Human
  UniProt ID Q9NY64
• Background: SLC2A8 is the insulin-regulated facilitative glucose transporter.SLC2A8 binds cytochalasin B in a glucose-inhibitable manner.SLC2A8 seems to be a dual-specific sugar transporter as it is inhibitable by fructose.
• Synonyms: GLUT8; GLUTX1
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%

Reference Data

• Protein Families: Transmembrane