Antibodies

Jump to Filters
View as table Download
SLC30A3 Rabbit Polyclonal Antibody
TA333995

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC30A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC30A3 Antibody: synthetic peptide directed towards the middle region of human SLC30A3. Synthetic peptide located within the following region: AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG
SLC30A3 Mouse Monoclonal Antibody [Clone ID: OTI2H6]
CF501498

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SLC30A3 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SLC30A3 Rabbit Polyclonal Antibody
TA366537

USD 380.00

4 Weeks

SLC30A3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC30A3
SLC30A3 Rabbit Polyclonal Antibody
TA370887

USD 380.00

4 Weeks

SLC30A3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC30A3
SLC30A3 Mouse Monoclonal Antibody [Clone ID: OTI2H6]
TA501498

USD 379.00

In Stock

Anti-SLC30A3 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SLC30A3 Mouse Monoclonal Antibody [Clone ID: OTI2H6]
TA501498S

USD 159.00

In Stock

Anti-SLC30A3 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated