SLC30A3 Rabbit Polyclonal Antibody

CAT#: TA333995

Rabbit Polyclonal Anti-SLC30A3 Antibody

Product Images

WB Suggested Anti-SLC30A3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate;SLC30A3 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: SLC30A3; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml;SLC30A3 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC30A3 Antibody: synthetic peptide directed towards the middle region of human SLC30A3. Synthetic peptide located within the following region: AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: solute carrier family 30 member 3
• Database Link:
  NP_003450
  Entrez Gene 7781 Human
  UniProt ID Q99726
• Background: SLC30A3 is involved in accumulation of zinc in synaptic vesicles.
• Synonyms: ZNT3
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane