Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SLC30A9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A9. |
Antibodies
View as table Download
Rabbit Polyclonal anti-SLC30A9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9. Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR |
Rabbit polyclonal anti-SLC30A9 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A9. |
Rabbit Polyclonal Anti-SLC30A9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9. Synthetic peptide located within the following region: LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQV |
Active filters
Target Symbol
- SLC30A9