Antibodies

Jump to Filters
View as table Download
SLC36A2 Rabbit Polyclonal Antibody
TA334624

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC36A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC36A2 antibody: synthetic peptide directed towards the N terminal of human SLC36A2. Synthetic peptide located within the following region: TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
SLC36A2 Rabbit Polyclonal Antibody
TA355004

USD 430.00

5 Days

Rabbit Polyclonal Anti-SLC36A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen SLC36A2 antibody was raised against a 15 amino acid peptide near the amino terminus of human SLC36A2. The immunogen is located within amino acids 30 - 80 of SLC36A2.