SLC36A2 Rabbit Polyclonal Antibody

CAT#: TA334624

Rabbit Polyclonal Anti-SLC36A2 Antibody

Product Images

WB Suggested Anti-SLC36A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

• 

  Skeletal muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC36A2 antibody: synthetic peptide directed towards the N terminal of human SLC36A2. Synthetic peptide located within the following region: TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: solute carrier family 36 member 2
• Database Link:
  NP_861441
  Entrez Gene 153201 Human
  UniProt ID Q495M3
• Background: SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.
• Synonyms: PAT2; TRAMD1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane