Antibodies

Jump to Filters
View as table Download
SLC37A3 Rabbit Polyclonal Antibody
TA333311

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC37A3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC37A3 Antibody: synthetic peptide directed towards the middle region of human SLC37A3. Synthetic peptide located within the following region: FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS