SLC37A3 Rabbit Polyclonal Antibody

CAT#: TA333311

Rabbit Polyclonal Anti-SLC37A3 Antibody

Product Images

WB Suggested Anti-SLC37A3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC37A3 Antibody: synthetic peptide directed towards the middle region of human SLC37A3. Synthetic peptide located within the following region: FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: solute carrier family 37 member 3
• Database Link:
  NP_996996
  Entrez Gene 84255 Human
  UniProt ID Q8NCC5
• Background: SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.
• Synonyms: FLJ16367; MGC32939
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Rabbit: 93%; Bovine: 92%; Dog: 86%; Rat: 85%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane