Rabbit Polyclonal ZIP6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ZIP6 antibody was raised against a 16 amino acid synthetic peptide near the center of human ZIP6. |
Rabbit Polyclonal ZIP6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ZIP6 antibody was raised against a 16 amino acid synthetic peptide near the center of human ZIP6. |
Rabbit Polyclonal Anti-SLC39A6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC39A6 Antibody: synthetic peptide directed towards the middle region of human SLC39A6. Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN |
SLC39A6 / LIV-1 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Immunogen | SLC39A6 / LIV-1 antibody was raised against synthetic 19 amino acid peptide from internal region of human SLC39A6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Orangutan, Monkey (95%); Gibbon, Marmoset (89%). |
SLC39A6 / LIV-1 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | SLC39A6 / LIV-1 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human SLC39A6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Orangutan, Gibbon, Horse (94%); Marmoset, Dog, Bovine, Panda (89%); Mouse, Rat, Bat, Rabbit (83%). |
SLC39A6 / LIV-1 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | SLC39A6 / LIV-1 antibody was raised against synthetic 20 amino acid peptide from internal region of human SLC39A6. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon (95%); Orangutan (90%); Monkey, Marmoset, Panda, Rabbit (85%); Bat, Dog (80%). |
Anti-SLC39A6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 303-315 amino acids of Human solute carrier family 39 (zinc transporter), member 6 |
Anti-SLC39A6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 303-315 amino acids of Human solute carrier family 39 (zinc transporter), member 6 |
SLC39A6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human SLC39A6 (NP_001092876.1). |
Modifications | Unmodified |