Antibodies

Jump to Filters
View as table Download
LAT3 (SLC43A1) Rabbit Polyclonal Antibody
TA314757

USD 345.00

4 Weeks

Rabbit polyclonal anti-LAT3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAT3.
LAT3 (SLC43A1) Rabbit Polyclonal Antibody
TA333992

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC43A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC43A1 Antibody: synthetic peptide directed towards the middle region of human SLC43A1. Synthetic peptide located within the following region: AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI