SLITRK6 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | SLITRK6 antibody was raised against 13amino acid peptide from near the center of human Slitrk6 |
SLITRK6 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | SLITRK6 antibody was raised against 13amino acid peptide from near the center of human Slitrk6 |
Rabbit Polyclonal Slitrk6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Slitrk6 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human Slitrk6. |
Rabbit Polyclonal Slitrk6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Slitrk6 antibody was raised against a 13 amino acid peptide from near the center of human Slitrk6. |
SLITRK6 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Hamster, Human, Rat |
Immunogen | SLITRK6 antibody was raised against synthetic 16 amino acid peptide from internal region of human SLITRK6. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Rat, Hamster (100%); Gorilla, Galago, Marmoset, Mouse, Elephant, Pig (94%); Panda, Bovine, Bat, Dog, Horse, Zebra finch, Chicken (88%); Opossum, Turkey (81%). |
SLITRK6 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | SLITRK6 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human SLITRK6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (88%); Elephant, Turkey, Chicken (81%). |
SLITRK6 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Human, Monkey, Pig |
Conjugation | Unconjugated |
Immunogen | SLITRK6 antibody was raised against synthetic 14 amino acid peptide from internal region of human SLITRK6. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Panda, Pig (100%); Gorilla, Mouse, Hamster, Elephant (93%); Rat, Horse, Opossum (86%). |
SLITRK6 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Gorilla, Horse, Human |
Immunogen | SLITRK6 antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human SLITRK6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Bovine, Horse (100%); Monkey, Bat (94%); Mouse, Elephant, Pig (88%); Rat, Dog, Panda (82%). |
Rabbit Polyclonal Anti-SLITRK6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLITRK6 antibody: synthetic peptide directed towards the N terminal of human SLITRK6. Synthetic peptide located within the following region: NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL |
SLITRK6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SLITRK6 |
SLITRK6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SLITRK6 |
SLITRK6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 621-816 of human SLITRK6 (NP_115605.2). |
Modifications | Unmodified |