Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SLU7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SLU7. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLU7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLU7 antibody: synthetic peptide directed towards the N terminal of human SLU7. Synthetic peptide located within the following region: KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH |
Carrier-free (BSA/glycerol-free) SLU7 mouse monoclonal antibody,clone OTI3C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLU7 mouse monoclonal antibody,clone OTI7C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Slu7 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
SLU7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SLU7 (NP_006416.3). |
| Modifications | Unmodified |
SLU7 mouse monoclonal antibody,clone OTI3C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SLU7 mouse monoclonal antibody,clone OTI3C8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SLU7 mouse monoclonal antibody,clone OTI3C8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SLU7 mouse monoclonal antibody,clone OTI3C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SLU7 mouse monoclonal antibody,clone OTI7C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SLU7 mouse monoclonal antibody,clone OTI7C8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SLU7 mouse monoclonal antibody,clone OTI7C8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SLU7 mouse monoclonal antibody,clone OTI7C8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SLU7