Rabbit polyclonal ARGBP2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARGBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-204 amino acids from the N-terminal region of human ARGBP2. |
Rabbit Polyclonal Anti-SORBS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SORBS2 antibody is: synthetic peptide directed towards the middle region of Human SORBS2. Synthetic peptide located within the following region: LRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPA |
SORBS2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SORBS2 |
SORBS2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SORBS2 |
Germany
Japan
United Kingdom
China
