SORBS2 Rabbit Polyclonal Antibody

CAT#: TA330292

Rabbit Polyclonal Anti-SORBS2 Antibody

Product Images

Host: Rabbit; Target Name: SORBS2; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SORBS2 antibody is: synthetic peptide directed towards the middle region of Human SORBS2. Synthetic peptide located within the following region: LRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: sorbin and SH3 domain containing 2
• Database Link:
  NP_001139142
  Entrez Gene 8470 Human
  UniProt ID O94875
• Background: SORBS2 is an adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. It can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 or with AKT1 and PAK1, thus mediating AKT1-mediated activation of PAK1.
• Synonyms: ARGBP2; PRO0618
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%; Rabbit: 86%