Antibodies

Jump to Filters
View as table Download
SPIB Rabbit Polyclonal Antibody
TA349059

USD 484.00

5 Days

Rabbit Polyclonal Anti-SREBF1 Antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SREBF1 antibody was raised against a 17 amino acid peptide near the center of human SREBF1.
SPIB Rabbit Polyclonal Antibody
TA329275

USD 375.00

5 Days

Rabbit Polyclonal anti-SPIB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPIB antibody: synthetic peptide directed towards the C terminal of human SPIB. Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA
SPIB Rabbit Polyclonal Antibody
TA335784

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPIB Antibody: synthetic peptide directed towards the middle region of human SPIB. Synthetic peptide located within the following region: WGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRR
SPIB Rabbit Polyclonal Antibody
TA336812

USD 424.00

5 Days

Rabbit Polyclonal Spi-B Antibody

Applications WB
Reactivities Human, Mouse, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 15-65 of human Spi-B was used as the immunogen.
SPIB Rabbit Polyclonal Antibody
TA381932

USD 220.00

3 Weeks

SPIB Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-262 of human SPIB (NP_003112.2).
Modifications Unmodified