Antibodies

View as table Download

Rabbit Polyclonal Anti-SREBF1 Antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SREBF1 antibody was raised against a 17 amino acid peptide near the center of human SREBF1.

Rabbit Polyclonal anti-SPIB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPIB antibody: synthetic peptide directed towards the C terminal of human SPIB. Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA

Rabbit Polyclonal Anti-SPIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPIB Antibody: synthetic peptide directed towards the middle region of human SPIB. Synthetic peptide located within the following region: WGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRR

Rabbit Polyclonal Spi-B Antibody

Applications WB
Reactivities Human, Mouse, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 15-65 of human Spi-B was used as the immunogen.

SPIB Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-262 of human SPIB (NP_003112.2).
Modifications Unmodified