Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-SPINK1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 24-79 amino acids of human serine peptidase inhibitor, Kazal type 1 |
Rabbit Polyclonal Anti-SPINK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPINK1 antibody: synthetic peptide directed towards the N terminal of human SPINK1. Synthetic peptide located within the following region: KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG |
SPINK1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SPINK1 |
SPINK1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SPINK1 |
Active filters
Target Symbol
- SPINK1