Germany
Japan
United Kingdom
China
SPINK1 Rabbit Polyclonal Antibody
Product Images
Other products for "SPINK1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SPINK1 antibody: synthetic peptide directed towards the N terminal of human SPINK1. Synthetic peptide located within the following region: KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 8 kDa |
| Gene Name | serine peptidase inhibitor, Kazal type 1 |
| Database Link | |
| Background | SPINK1 is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. |
| Synonyms | PCTT; PSTI; Spink3; TATI; TCP |
| Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 93% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.