Antibodies

Jump to Filters
View as table Download
SPINK9 Rabbit Polyclonal Antibody
TA334385

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPINK9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPINK9 antibody is: synthetic peptide directed towards the middle region of Human SPINK9. Synthetic peptide located within the following region: KKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGK
SPINK9 Rabbit Polyclonal Antibody
TA358974

USD 360.00

5 Days

SPINK9 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SPINK9