SPINK9 Rabbit Polyclonal Antibody

CAT#: TA334385

Rabbit Polyclonal Anti-SPINK9 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SPINK9"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SPINK9 antibody is: synthetic peptide directed towards the middle region of Human SPINK9. Synthetic peptide located within the following region: KKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 9 kDa
Gene Name serine peptidase inhibitor, Kazal type 9
Background SPINK9 is a Serine protease inhibitor which specifically inhibits KLK5. It may contribute to the regulation of the desquamation process in skin by inhibiting KLK5.
Synonyms LEKTI2
Note Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Dog: 92%; Rabbit: 92%; Rat: 90%; Pig: 85%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.