Germany
Japan
United Kingdom
China
SRPR beta (SRPRB) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Canine, Chicken |
| Immunogen | Synthetic peptide corresponding to amino acids 246-265 derived from the carboxyl terminal of the canine SRbeta subunit |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SRPRB Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the middle region of human SRPRB. Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE |
SRPR beta (SRPRB) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 206-236 amino acids from the C-terminal region of Human SRPRB. |
Rabbit Polyclonal Anti-SRPRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the C terminal of human SRPRB. Synthetic peptide located within the following region: APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI |
SRPRB Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 57-271 of human SRPRB (NP_067026.3). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
Active filters
Target Symbol
- SRPRB