Rabbit polyclonal antibody to serine/threonine kinase 40 (serine/threonine kinase 40)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 156 and 372 of serine/threonine kinase 40 (Uniprot ID#Q8N2I9) |
Rabbit Polyclonal Anti-STK40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK40 antibody is: synthetic peptide directed towards the N-terminal region of Human STK40. Synthetic peptide located within the following region: ILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDR |
Rabbit Polyclonal Anti-STK40 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STK40 |
STK40 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STK40 |
Germany
Japan
United Kingdom
China
