STK40 Rabbit Polyclonal Antibody

CAT#: TA342984

Rabbit Polyclonal Anti-STK40 Antibody

Product Images

Host: Rabbit; Target Name: STK40; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK40 antibody is: synthetic peptide directed towards the N-terminal region of Human STK40. Synthetic peptide located within the following region: ILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: serine/threonine kinase 40
• Database Link:
  NP_114406
  Entrez Gene 83931 Human
  UniProt ID Q8N2I9
• Background: STK40 may be a negative regulator of NF-kappa-B and p53-mediated gene transcription.
• Synonyms: SgK495; SHIK
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase