Antibodies

Jump to Filters
View as table Download
STRBP Rabbit Polyclonal Antibody
TA343878

USD 475.00

5 Days

Rabbit Polyclonal Anti-STRBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STRBP antibody: synthetic peptide directed towards the middle region of human STRBP. Synthetic peptide located within the following region: PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS
STRBP Rabbit Polyclonal Antibody
TA382153

USD 220.00

3 Weeks

STRBP Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-190 of human STRBP (NP_060857.2).
Modifications Unmodified