STRBP Rabbit Polyclonal Antibody

CAT#: TA343878

Rabbit Polyclonal Anti-STRBP Antibody

Product Images

WB Suggested Anti-STRBP Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STRBP antibody: synthetic peptide directed towards the middle region of human STRBP. Synthetic peptide located within the following region: PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: spermatid perinuclear RNA binding protein
• Database Link:
  NP_060857
  Entrez Gene 55342 Human
  UniProt ID Q96SI9
• Background: STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.
• Synonyms: HEL162; ILF3L; p74; SPNR
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Yeast: 80%

Reference Data

• Protein Families: Stem cell - Pluripotency