Rabbit Polyclonal Anti-SUFU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD |
Suppressor of Fused (SUFU) pSer342 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around phosphorylation site of Serine 342 derived from Human Sufu |
Suppressor of Fused (SUFU) pSer342 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around phosphorylation site of Serine 342 derived from Human Sufu |
Rabbit Polyclonal Anti-SUFU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUFU Antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: NGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGS |
Rabbit Polyclonal Anti-SUFU Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUFU Antibody: synthetic peptide directed towards the N terminal of human SUFU. Synthetic peptide located within the following region: HAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNVGSPSANI |
SUFU Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SUFU |
SUFU Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human SUFU |
SUFU rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SUFU |
SUFU Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 325-484 of human SUFU (NP_057253.2). |
| Modifications | Unmodified |
SUFU Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 325-484 of human SUFU (NP_057253.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
