Rabbit Polyclonal Anti-SUPT6H Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUPT6H antibody: synthetic peptide directed towards the N terminal of human SUPT6H. Synthetic peptide located within the following region: EAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGF |
Spt6 (SUPT6H) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 98-127 amino acids from the N-terminal region of human SUPT6H |
Rabbit Polyclonal Anti-SUPT6H Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-SUPT6H Antibody: synthetic peptide directed towards the N terminal of human SUPT6H. Synthetic peptide located within the following region: EGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR |
Rabbit Polyclonal Anti-SUPT6H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUPT6H Antibody is: synthetic peptide directed towards the N-terminal region of Human SUPT6H. Synthetic peptide located within the following region: FVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGN |
Rabbit Polyclonal Anti-SUPT6H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SUPT6H antibody is: synthetic peptide directed towards the C-terminal region of Human SUPT6H. Synthetic peptide located within the following region: RQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIEST |
SUPT6H Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1500-1726 of human SUPT6H (NP_003161.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
