SUPT6H Rabbit Polyclonal Antibody

CAT#: TA333888

Rabbit Polyclonal Anti-SUPT6H Antibody

Product Images

WB Suggested Anti-SUPT6H Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysateSUPT6H is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SUPT6H Antibody: synthetic peptide directed towards the N terminal of human SUPT6H. Synthetic peptide located within the following region: EGSDSGDSEDDVGHKKRKRTSFDDRLEDDDFDLIEENLGVKVKRGQKYRR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 199 kDa
• Database Link:
  NP_033323.2
• Background: SUPT6H may be functionally analogous to SPT6 and emb-5 and may therefore regulate transcription through establishment or maintenance of chromatin structure. Spt6 may also participates in the regulation of transcription by RNA polymerase II (RNAPII). Human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RNAPII elongation. HSpt6 is capable of stimulating transcription elongation both individually and in concert with DRB sensitivity-inducing factor (DSIF).
• Note: Immunogen sequence homology: Chicken: 100%; Dog: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 85%