Antibodies

Jump to Filters
View as table Download
SV2B Rabbit Polyclonal Antibody
TA341963

USD 375.00

5 Days

Rabbit Polyclonal Anti-SV2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SV2B antibody is: synthetic peptide directed towards the C-terminal region of Human SV2B. Synthetic peptide located within the following region: TINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTY
SV2B Rabbit Polyclonal Antibody
TA382224

USD 220.00

3 Weeks

SV2B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 415-540 of human SV2B (NP_055663.1).
Modifications Unmodified