SV2B Rabbit Polyclonal Antibody

CAT#: TA341963

Rabbit Polyclonal Anti-SV2B Antibody

Product Images

Host: Rabbit; Target Name: SV2B; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SV2B antibody is: synthetic peptide directed towards the C-terminal region of Human SV2B. Synthetic peptide located within the following region: TINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: synaptic vesicle glycoprotein 2B
• Database Link:
  NP_055663
  Entrez Gene 9899 Human
  UniProt ID Q7L1I2
• Background: Probably plays a role inThe control of regulated secretion in neural and endocrine cells.
• Synonyms: HsT19680
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: ECM-receptor interaction